SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10956743|ref|NP_061688.1|NC_002490 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10956743|ref|NP_061688.1|NC_002490
Domain Number 1 Region: 23-115,144-243
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.66e-30
Family Hydroxynitrile lyase-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|10956743|ref|NP_061688.1|NC_002490
Sequence length 251
Comment hypothetical protein XFa0032 [Xylella fastidiosa 9a5c plasmid pXF51]
Sequence
MNAYRPIAFASSAASDKPTVLLKPTIVLVHGAFADGSTWNKVIHQLQAKGLNAVSVQNPL
TSFEDDVAATRRVLALQTGPVVLVGHSYGGAVITEAGQDERVKALVYIAAFAPSEGESVA
DLNKKYPLPSGYNHLSSDKEGFLMLTPEGVEKYLAQDIPLEQTRLIIATQHPIRGANFEK
KVSAAAWETKPSWYLVSENDLMLQPALQKEMAQKIGAHIVNVAASHVPHLSHAAEVEKII
MSAVNDVEVLE
Download sequence
Identical sequences Q9PHH3
160492.XFa0032 WP_010895228.1.4338 WP_010895228.1.45907 WP_010895228.1.82282 WP_010895228.1.82778 WP_010895228.1.94175 gi|10956743|ref|NP_061688.1|NC_002490 gi|10956743|ref|NP_061688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]