SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111024866|ref|YP_707286.1|NC_008269 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111024866|ref|YP_707286.1|NC_008269
Domain Number 1 Region: 3-276
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.43e-68
Family Carbon-carbon bond hydrolase 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111024866|ref|YP_707286.1|NC_008269
Sequence length 277
Comment alpha/beta-fold C-C bond hydrolase [Rhodococcus jostii RHA1 plasmid pRHL1]
Sequence
MTTTTDQSPEIAKTIDVNGIATNYHDVGEGAPVVLIHGSGPGVTAWANWRTTIPHLAEKF
RVIAPDILGFGYTERPDGVEYNSTTWTQHLVGLLDALGLDTVSIVGNSFGGSLALNIATK
HPERVDRLVLMGSVGVPFEITDGLDAVWGFEPSLPAMRKLLDVFAYDRSLVNDELAELRL
AAATRPGVQEAFSAMFPAPRQQGVDEMAVDETLIAGLTNDTLIVHGRDDQVIPLSNSLRL
LELIDRSQLHVFGRCGHWVQIEHSARFNSLIADFLSE
Download sequence
Identical sequences Q0S008
gi|111024866|ref|YP_707286.1|NC_008269 WP_011599023.1.78234 gi|111024866|ref|YP_707286.1| 101510.RHA1_ro08081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]