SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111025615|ref|YP_708035.1|NC_008269 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111025615|ref|YP_708035.1|NC_008269
Domain Number 1 Region: 2-282
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.23e-59
Family Epoxide hydrolase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111025615|ref|YP_708035.1|NC_008269
Sequence length 293
Comment epoxide hydrolase [Rhodococcus jostii RHA1 plasmid pRHL1]
Sequence
MRSTPVDGFRLTYDRAGSGWPVVLLHGWPGDRTDYRDMVPLLSESLDVVIPDLRGFGTSD
KHDADPAEQYSAKAQARSIAGLIEELDLERPVIAGYDIGSRTAQTLATCRPDLVGALVVA
PPLPGVGRRALDESAQREFWYQAFHQSPLIECLIDGKPDAVRDYLAYIWGRWSGPHYAVH
SDQLEHLVSVYGAPGAFAASIAWYRAGAGAVATSLAEATPEPGRRVGMPTKVLWPEHDPL
FPREWSDRLDDFFSDVELRYLDGVGHFSPLEAPQPFAAEVLSAADRLNSGKAV
Download sequence
Identical sequences Q0RXV9
WP_011599558.1.78234 gi|111025615|ref|YP_708035.1| 101510.RHA1_ro08833 gi|111025615|ref|YP_708035.1|NC_008269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]