SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111026204|ref|YP_708487.1|NC_008270 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111026204|ref|YP_708487.1|NC_008270
Domain Number 1 Region: 23-273
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.92e-63
Family Carbon-carbon bond hydrolase 0.000000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111026204|ref|YP_708487.1|NC_008270
Sequence length 285
Comment 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus jostii RHA1 plasmid pRHL2]
Sequence
MAKTVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFF
VVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQL
VVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGM
EEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVP
LDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRAA
Download sequence
Identical sequences O05149 Q6REQ4 Q75WN8
gi|111026204|ref|YP_708487.1|NC_008270 gi|111026204|ref|YP_708487.1| 1c4x_A WP_011599998.1.53434 WP_011599998.1.78234 101510.RHA1_ro10136 cath|current|1c4xA00/3-283 1c4xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]