SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113473786|ref|YP_718049.1|NC_008308 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113473786|ref|YP_718049.1|NC_008308
Domain Number 1 Region: 3-232
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.51e-37
Family Hydroxynitrile lyase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113473786|ref|YP_718049.1|NC_008308
Sequence length 235
Comment putative alkyl salicylate esterase [Sphingomonas sp. KA1 plasmid pCAR3]
Sequence
MSTFILIHGAWHGRWCWDELIPLLEAGKHKVVAIDLPGSGDDPTPPGDVSLAAYCDAVVH
TVCSQGEPVVLVGHSMGGLVITQVAELIPERVAALVYVAAFLPDNGQSLKQLADQGAPLS
LEYSADGLTAIIPPQSASDTLFADVHLDICKSAVAKLRPQALAPLGTPVETTPERFGSVP
RHYVECIRDRAIPIEAQRKMAAANTCVSIQSLETGHSPFLSAPAQLANALLNTTS
Download sequence
Identical sequences A0A1G4UFG0 Q0KJK5
gi|113473786|ref|YP_718049.1|NC_008308 WP_011608004.1.48345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]