SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114883618|ref|YP_740308.1|NC_008330 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114883618|ref|YP_740308.1|NC_008330
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.74e-64
Family Haloalkane dehalogenase 0.000000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114883618|ref|YP_740308.1|NC_008330
Sequence length 296
Comment 1,4-TCDN halidohydrolase [uncultured bacterium plasmid pLB1]
Sequence
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIA
CDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARR
HRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILR
PLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLF
INAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Download sequence
Identical sequences A0A1L5BTC1 A4PEU6 Q0KKN4 Q306E6 Q6VQX3
WP_007682110.1.101124 WP_007682110.1.17317 WP_007682110.1.55674 gi|114883618|ref|YP_740308.1|NC_008330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]