SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116249582|ref|YP_765420.1|NC_008379 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116249582|ref|YP_765420.1|NC_008379
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.58e-40
Family Carbon-carbon bond hydrolase 0.079
Further Details:      
 
Domain Number 2 Region: 267-332
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.56e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116249582|ref|YP_765420.1|NC_008379
Sequence length 333
Comment hydrolase/GerE family transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9]
Sequence
MASCGQGQVILRAAHWLSHVDYDLESPVWRPWLQALSAHNRFVRYDPRGCGLSDRHVFDL
SVEAWHADLAAVAASIEEPRFVLLGLSQGGALAIAYALKYPERVSHLVLLNAYGQGARAR
AQTEAERLEAETLVNFVRVGWGRDNPAFCRFFTNLFIPDGTPEQHRWWGDLERQTATADV
AAQLLWQMQGIDVLDLAAMLRVPTLIAHSRGDMRVPFDQGCKLAAAIPGASFVPLESKNH
VLLPDEPAWNVFQTELAAFLGQDRSVRPRAVSEAGLTPAEAALLDLVAEGLDNRAIAERL
GKSAKTVRNQLSVIFSKLGVHSRSQAIVVALSR
Download sequence
Identical sequences Q1M8U4 W0IRL9
216596.pRL90128 gi|116249582|ref|YP_765420.1|NC_008379 gi|116249582|ref|YP_765420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]