SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119633061|ref|YP_918951.1|NC_008690 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119633061|ref|YP_918951.1|NC_008690
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.84e-74
Family CAT-like 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119633061|ref|YP_918951.1|NC_008690
Sequence length 213
Comment chloramphenicol resistant protein [Vibrio sp. TC68 plasmid pTC68]
Sequence
MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITALRTALAETDYKFYPVMIYLISR
VVNQFPEFRMAMKDNALIYWDQTDPVFTVFHKETETFSALFCRYCPDISEFMAGYNAVMA
EYQHNTALFPQGALPENHLNISSLPWVSFDGFNLNITGNDDYFAPVFTMAKFQQEDNRVL
LPVSVQVHHAVCDGFHAARFINTLQMMCDNILK
Download sequence
Identical sequences A0A0F5ENK2 A0A0R5RPW5 A0A125XXX4 A0A1J0E686 A0ZSZ6 B3VMZ0 Q6A290 Q8RQP2
gi|119633061|ref|YP_918951.1|NC_008690 gi|209947535|ref|YP_002291032.1|NC_011409 gi|253723690|ref|YP_003023976.1|NC_012919 WP_011751353.1.12797 WP_011751353.1.19715 WP_011751353.1.26815 WP_011751353.1.29290 WP_011751353.1.36927 WP_011751353.1.41103 WP_011751353.1.43514 WP_011751353.1.45092 WP_011751353.1.46458 WP_011751353.1.55418 WP_011751353.1.60575 WP_011751353.1.62706 WP_011751353.1.63380 WP_011751353.1.63549 WP_011751353.1.70647 WP_011751353.1.72215 WP_011751353.1.75193 WP_011751353.1.77494 WP_011751353.1.84729 WP_011751353.1.8511 WP_011751353.1.86649 WP_011751353.1.99406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]