SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124262561|ref|YP_001023031.1|NC_008826 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124262561|ref|YP_001023031.1|NC_008826
Domain Number - Region: 190-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0101
Family Carboxylesterase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124262561|ref|YP_001023031.1|NC_008826
Sequence length 284
Comment hypothetical protein Mpe_B0015 [Methylibium petroleiphilum PM1 plasmid RPME01]
Sequence
MRLGFMPYADVVLEERSTSRRVWVEFEVSRADPVANHAKFGTSAFLERTHRDGDAFVSMA
SRHIAPGRLALAAGTAMLMRGFGIAAFQIDLLPKFSAADIKRLNSGRIPAELDARSELER
ALRVSDAEVTDDGHRIHKVDNHFAVAVNVRQWNAEMLDLALSSVWGRRRVSYCVYDRASR
LFAPSKFCAFVPTVQTATAADLPALLAGRPAGMTMPIYATLGEVDKRFDGAIAWKHLHQG
LSYDLVKLEGATHSIRSDFERWRAQMAAALDIRDPKLLLPPVRA
Download sequence
Identical sequences A2SMK7
gi|124262561|ref|YP_001023031.1| gi|124262561|ref|YP_001023031.1|NC_008826 420662.Mpe_B0015 WP_011831413.1.77188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]