SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146275515|ref|YP_001165676.1|NC_009426 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146275515|ref|YP_001165676.1|NC_009426
Domain Number 1 Region: 4-283
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.8e-39
Family Haloperoxidase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146275515|ref|YP_001165676.1|NC_009426
Sequence length 294
Comment alpha/beta hydrolase fold [Novosphingobium aromaticivorans DSM 12444 plasmid pNL1]
Sequence
MSNPHVTLSGHSGHAIAALTEGPEQGFPVLLAHGGGQTKRAWKQVTAMLARHGFRAIALD
LRGHGDSAWADDGAYDIVDFAGDLVAIAGSLDRKPALIGASLGGLAGIMAEGEVAPGSFA
SLTLVDITPQMEAGGVTRVVGFMAAHAREGFASPDEAARVISEYLPHRPSRKASSGLAHY
LRLKPDGRYYWHWDPAFIDGIMRRNAERGDGSDYGRGELGEAAARLALPVHLIRGGSSDL
VSPEAVAHFRALVPHAAYSDIADATHMVVGDQNDAFGDAILDFLMRTHGTEIAA
Download sequence
Identical sequences A4XDY9
gi|146275515|ref|YP_001165676.1|NC_009426 279238.Saro_3907 WP_011906633.1.26809 WP_011906633.1.47728 WP_011906633.1.7588 WP_011906633.1.96002 gi|146275515|ref|YP_001165676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]