SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148243719|ref|YP_001219959.1|NC_009467 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148243719|ref|YP_001219959.1|NC_009467
Domain Number 1 Region: 107-298
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.93e-38
Family PHB depolymerase-like 0.012
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000523
Family PHB depolymerase-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148243719|ref|YP_001219959.1|NC_009467
Sequence length 308
Comment PHB depolymerase family esterase [Acidiphilium cryptum JF-5 plasmid pACRY01]
Sequence
MSAGCVSEVVGFGSNPGALRMLVHARARLPAGRPLVVVLHGCGQDAAAFANASGWLALAD
ELGFALLVPEQVHANNRGRCFNWFRPDDVRRSGGEAMSIRQMLRVAVARYGSDPRRIYIV
GFSAGGGMAAAMLAAYPAVFAAGGIVAGMPVGCAQTQVAAMLHMRRANMSRSRQALAGDV
RAVTQARSRRSWPRVSIWQGGRDRTVDPANAEILAAQWGELHGQDTAPRTDNVASGHRHR
TWGRPDRPPAVEIWTLPAIGHGFPVDASLPGSGRTSPYLARADLSAARQIATFWLLNNDH
AKRAALHR
Download sequence
Identical sequences A0A257R295 A0A257S3G1 A5FT39
349163.Acry_3146 349163.Acry_3195 WP_011930507.1.19560 gi|148243673|ref|YP_001219913.1| gi|148243719|ref|YP_001219959.1| gi|148243673|ref|YP_001219913.1|NC_009467 gi|148243719|ref|YP_001219959.1|NC_009467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]