SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150376348|ref|YP_001312944.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376348|ref|YP_001312944.1|NC_009620
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.28e-62
Family Haloperoxidase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376348|ref|YP_001312944.1|NC_009620
Sequence length 268
Comment 3-oxoadipate enol-lactonase [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MQFTRINDVTIHYRVVGAVAEKPVLVFINSLGTDFRIWRDLVLRLSGDFAIVLYDKRGHG
LSDIGQVPYSIEDHATDLAGLLDRLAVKGAIVCGLSVGGLVAQSLCVRRPDLVHALVLSD
TAHKIGTTEFWDARIAAIEAHGIEAIADGILERWFTAAFRRPENTAFAGYRNMLVRQPVP
GYIGTCAAIRDADFTQAAGKIAVPVLCVVGEEDGSTPPDLVRSTAQLIPGASFEVICGAG
HIPCVEQPEALTSVLRRFFRTVLPGENP
Download sequence
Identical sequences A6UH81
gi|150376348|ref|YP_001312944.1| gi|150376348|ref|YP_001312944.1|NC_009620 366394.Smed_4206 WP_011969833.1.29075 WP_011969833.1.31871 WP_011969833.1.61285 WP_011969833.1.7720 WP_011969833.1.89664 YP_001312944.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]