SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377372|ref|YP_001313967.1|NC_009621 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377372|ref|YP_001313967.1|NC_009621
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.6e-40
Family Carboxylesterase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377372|ref|YP_001313967.1|NC_009621
Sequence length 283
Comment hypothetical protein Smed_5258 [Sinorhizobium medicae WSM419 plasmid pSMED02]
Sequence
MTSQDLYRIRDFVPDFDAIAAEFAERSRALSAETNVLADLRYGSRTREVLDVILPEHPKA
GAPLHVFVHGGYWRSGEKENYRFVAKPVLAAGGVAAFIEYDLMPGTRLNVLVDQVRRSVL
WLQHHAGDFDADCRRLTVSGHSAGAHLASYLAATGSSETREPSLPSIQGVLFLSGIYDLS
GIPNSFLRDEAQMTAAEANAWSPLTSSQHPCPRRIVGYGGDETTPFHDQAMQFQAVLASK
NEKAELLAAPGFNHMSVVLDLADPDGLIGRTLHDLVAEKVPNV
Download sequence
Identical sequences A6UK54
366394.Smed_5258 gi|150377372|ref|YP_001313967.1| WP_011970143.1.29075 YP_001313967.1.44884 gi|150377372|ref|YP_001313967.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]