SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159186507|ref|NP_396076.2|NC_003064 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159186507|ref|NP_396076.2|NC_003064
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-41
Family Prolyl oligopeptidase, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159186507|ref|NP_396076.2|NC_003064
Sequence length 251
Comment putative peptidase [Agrobacterium fabrum str. C58 plasmid At]
Sequence
MAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLLGGQEAVEDGSLVRFSS
RLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALDFLKRQPSVDPERIVLYGNSRGAV
ASAMVATKVADLKAIILTGGVYDLRDAYKTSARGLQEAIRNEAGISDEAFLDRSALYHAH
SIRSETLLLHGKYDDRASVDQAERFSEALARSGVPVRFHALDGGHRLPRDQVTPILRDFL
TRVFAPMATIH
Download sequence
Identical sequences H0HEH1 Q7D3T6 Q9WWD0
NP_396076.2.86381 WP_003517297.1.33939 WP_003517297.1.35372 WP_003517297.1.51814 WP_003517297.1.57042 WP_003517297.1.62720 176299.Atu5144 gi|159186507|ref|NP_396076.2| gi|159186507|ref|NP_396076.2|NC_003064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]