SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159186539|ref|NP_396142.2|NC_003064 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159186539|ref|NP_396142.2|NC_003064
Domain Number 1 Region: 4-219
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.92e-27
Family Hydroxynitrile lyase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159186539|ref|NP_396142.2|NC_003064
Sequence length 229
Comment hypothetical protein Atu5212 [Agrobacterium fabrum str. C58 plasmid At]
Sequence
MKNVVLVHGAFADGSGWKGVYDNLTKRGYRVTVVQNPLTSLADDVAATKRALERQDGPVI
LVGHSWGGTVITEAGSDEKVAGLVYVSALSPDAGETTAQQYEGFAPASEFVIETTKDGFG
YVSPAKFKSGFAHDVSDADVAFMSSSQVPINMSAFGTKLENAAWRTKPSWAVIATEDKAF
DQAMLIHMAERIKAKITKVSASHALFMTQPAVIADTIDKAAKTVSAKKQ
Download sequence
Identical sequences Q7D3M5
gi|159186539|ref|NP_396142.2| gi|159186539|ref|NP_396142.2|NC_003064 176299.Atu5212 NP_396142.2.86381 WP_010974470.1.51814 WP_010974470.1.57042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]