SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16262681|ref|NP_435474.1|NC_003037 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16262681|ref|NP_435474.1|NC_003037
Domain Number - Region: 3-138
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00575
Family Fungal lipases 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16262681|ref|NP_435474.1|NC_003037
Sequence length 156
Comment hypothetical protein SMa0433 [Sinorhizobium meliloti 1021 plasmid pSymA]
Sequence
MTKVTVIAHSPGAPVSRRALLDAIRNQASWAGKTRLQLFAPAHIGAYLNKVRKELGIASR
LIASLTALTKFGVLSLDGLEPGSPFLTQLMEDSSKELANGWDAQVKARQVIFGDGENVVM
VQRFLEDPPHTVWPGHGHCSVCRCDKTAPAIASYLA
Download sequence
Identical sequences Q930G8
gi|16262681|ref|NP_435474.1|NC_003037 gi|470184215|ref|YP_007572188.1|NC_020527 NP_435474.1.96377 WP_010967226.1.4234 WP_010967226.1.787 gi|16262681|ref|NP_435474.1| 266834.SMa0433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]