SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170745206|ref|YP_001766663.1|NC_010510 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170745206|ref|YP_001766663.1|NC_010510
Domain Number 1 Region: 28-124,153-250
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.27e-26
Family Hydroxynitrile lyase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170745206|ref|YP_001766663.1|NC_010510
Sequence length 259
Comment hypothetical protein Mrad2831_5922 [Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01]
Sequence
MMTRRTLNRALAASAAAALLPGAAEAQDPPRARNVVLVHGLFADGSCWSEVIPHLQAAGL
TVTSVQNPLTTFEEAVAAAQRVLARQEGPTVLVGHSFSGMIVTEAGIDPKVSALVYVAAR
APDANEDYAALARTYPTPPAAAGIVFDGDEGRLSEAAFLRDFAGDLPAERARVLFAVQQP
FRKALLTGRTTHAAWRSKPSFYAVSTEDRTIDPDLERFMAKRMNARTVELKASHLSLISR
APDIADLILEAAGQPRRRR
Download sequence
Identical sequences A0A0M8ZAV1 B1M8N6
426355.Mrad2831_5922 gi|170745206|ref|YP_001766663.1| gi|170745206|ref|YP_001766663.1|NC_010510 WP_012329658.1.31760 WP_012329658.1.35747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]