SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172064576|ref|YP_001812226.1|NC_010553 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|172064576|ref|YP_001812226.1|NC_010553
Domain Number - Region: 12-59
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0582
Family Carboxylesterase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|172064576|ref|YP_001812226.1|NC_010553
Sequence length 59
Comment hypothetical protein BamMC406_6552 [Burkholderia ambifaria MC40-6 plasmid pBMC401]
Sequence
MESHEHEPTLPAGLVVFSADGRVQFGWLNPETDQYWSEATGEVIRDAVGAVQWVSDRAH
Download sequence
Identical sequences B1Z6A0
gi|172064576|ref|YP_001812226.1| gi|172064576|ref|YP_001812226.1|NC_010553 398577.BamMC406_6552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]