SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17549016|ref|NP_522356.1|NC_003296 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17549016|ref|NP_522356.1|NC_003296
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.07e-23
Family Haloperoxidase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17549016|ref|NP_522356.1|NC_003296
Sequence length 290
Comment hypothetical protein RS01912 [Ralstonia solanacearum GMI1000 plasmid pGMI1000MP]
Sequence
MHTDAFPVSLAAADGYVLGGCRYPADTALKGRLVVAGATAVPQGFYRRFAQFAGTRGFET
LTFDYRGIGQSRPPSLHGLRTDFLDWARLDLAAAVDTMADGAVPLYVVGHSYGGHAFGLL
PNHRKVAGFCVFGTGAGWHGYMPLGERLRVLAMWNAVLPVLTWWKGYCPWKMLGLGEDLP
VGVYRQWRHWCRFPRYLFDDPAMRGIEQAYADVRTPIVAVNALDDLWAPPASRDAFMQGY
RNAPLTRKDLDPRQIGGKVGHMGYFRQAGEPLWERMLGWFSSLPRTTATR
Download sequence
Identical sequences A0A0S4X2S4 A0A223GUT3 Q8XRN6
267608.RS01912 WP_011004093.1.81933 gi|17549016|ref|NP_522356.1|NC_003296 gi|17549016|ref|NP_522356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]