SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17549450|ref|NP_522790.1|NC_003296 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17549450|ref|NP_522790.1|NC_003296
Domain Number 1 Region: 17-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.62e-40
Family Proline iminopeptidase-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17549450|ref|NP_522790.1|NC_003296
Sequence length 272
Comment hypothetical protein RS03173 [Ralstonia solanacearum GMI1000 plasmid pGMI1000MP]
Sequence
MHAQGEFANMRLPLVVDGAALDIAAIHRPGERPPILFLHGFGSTKEDYADIVRHPAFDGR
PFVAYDAPGCGETACADLSRISIPFLVKTAEAVLDHFGWRTFHLVGHSMGGLTALMLASR
WPDRVLSFTDIEGNIAPEDCFLSRQIVGDPEADAERFFDAFIERTRHAPAYASALYAASL
RHKVRAGAVRGIFESMVDLSDNGGLMDRFLGLPCPRLFMYGEQNASLSYLRHIQAHGVAL
AEIPACGHFPMYSNPVLMWERIARFQAHAGAA
Download sequence
Identical sequences A0A223GVR9 Q8XQJ6
gi|17549450|ref|NP_522790.1| gi|17549450|ref|NP_522790.1|NC_003296 267608.RS03173 WP_011004513.1.81933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]