SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186470362|ref|YP_001861680.1|NC_010625 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186470362|ref|YP_001861680.1|NC_010625
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.49e-30
Family Hypothetical protein TT1662 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186470362|ref|YP_001861680.1|NC_010625
Sequence length 258
Comment hypothetical protein Bphy_5559 [Burkholderia phymatum STM815 plasmid pBPHY01]
Sequence
MMDDPESLSLALPDGTKVSALLRVPEDARALYVFAHGAGAGMQHAGMSSLADALAAANVA
TLRYQFPYMERGSKRVDSPAVAHAAVQAAVAEARRRLPALPLFAGGRSFGGRMTSQAQAI
SPLDGVRGLAFVAFPLHPAGAPGVERARHLTHVTVPILFLQGTRDKLAELPLLRSVVETL
GPRATLHVVDDADHSFHVRASSGRTDAEVVLELARNACSRVGTASRRSRRAALARSFPSL
SADGRSHSHNKRRLSRQR
Download sequence
Identical sequences B2JUB2
391038.Bphy_5559 gi|186470362|ref|YP_001861680.1|NC_010625 gi|186470362|ref|YP_001861680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]