SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188591357|ref|YP_001795956.1|NC_010529 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188591357|ref|YP_001795956.1|NC_010529
Domain Number 1 Region: 3-138,183-296
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.25e-37
Family Dienelactone hydrolase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188591357|ref|YP_001795956.1|NC_010529
Sequence length 297
Comment hydrolase [Cupriavidus taiwanensis LMG 19424 plasmid pRALTA]
Sequence
MMMRKVSFKRDGLTLAGNLFEPENLNESGRYPAVVVAGSLSSVKEQMAGAYGRTLAENGF
VALVIDYSHYGESEGQPRQLESPAAKLSDLKAAVSYLTALPYTKAIGMVGVCTSGGNGAY
LVAADERVKAFATVAAFLPDPELNERLVGAAEIARRRAAGAEAKLRFERSGEQVTVPTYS
VDDPSALNYNPKGNYDYYFNKARGGVPEWKNEFAVMSHGPWLDFDPVSKASAIKVPTIMV
HSDGCAFPEQAKKFYSLLGAVKELAWGDGTHFDYYDQPAQIDYAVKNVAAFLHKHLS
Download sequence
Identical sequences B2AJR5
WP_012354429.1.21467 WP_012354429.1.63293 WP_012354429.1.84351 gi|188591357|ref|YP_001795956.1|NC_010529 164546.pRALTA_0040 gi|188591357|ref|YP_001795956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]