SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189332439|ref|YP_001941136.1|NC_010795 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189332439|ref|YP_001941136.1|NC_010795
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.13e-77
Family CAT-like 0.00000000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189332439|ref|YP_001941136.1|NC_010795
Sequence length 213
Comment chloramphenicol acetyltransferase type III [Actinobacillus pleuropneumoniae plasmid pHB0503]
Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQ
AVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVME
RYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL
LPLSVQVHHAVCDGFHVARFISRLQELCNSKLK
Download sequence
Identical sequences A0A1T0CLB2 A0A256BT45 A0A263J8Y3 A4LA81 B3GPP3 C5S4Z2 D0ZHK9 J7FWM6 Q06W23 Q2A6M0 Q7B0A8 Q7B158 Q9L3N8
498217.ETAE_p044 gi|12084929|ref|NP_073222.1|NC_002637 gi|18875441|ref|NP_573537.1|NC_003411 gi|189332439|ref|YP_001941136.1|NC_010795 gi|268593696|ref|YP_003297638.1|NC_013509 gi|32455905|ref|NP_862668.1|NC_004973 gi|410687006|ref|YP_006965142.1|NC_019361 gi|89142216|ref|YP_512238.1|NC_007800 gi|268593696|ref|YP_003297638.1| WP_005826111.1.2841 WP_005826111.1.47891 WP_005826111.1.58026 WP_005826111.1.93598 WP_005826111.1.99713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]