SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190014795|ref|YP_001967559.1|NC_010929 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190014795|ref|YP_001967559.1|NC_010929
Domain Number 1 Region: 14-282
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.57e-52
Family Biotin biosynthesis protein BioH 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190014795|ref|YP_001967559.1|NC_010929
Sequence length 283
Comment orf_Bo162 [Agrobacterium tumefaciens plasmid Ti plasmid pTiBo542]
Sequence
MNRNPHNADWKATPTEHVEAAGTRFAYRRLGPDVGVPIVLLNHWGANLDNFDPRIVEGLA
SVRPVYALDYRGVGNSGGMAPLSVAEMAADTIATIQALGLTSADLIGFSLGGFVAQQILF
DEPNLVRRAILAGTGPAGGTGIERVGRVSWPLIVKGLLTFSDPKFYLFFTSSSKSRQAAK
AFLARLKERTRDRDKAVSLKAFLRQLKAIKAWGLQAPHSLDTIRTPVLVANGDHDIMVPS
ENSSDLARRIPGAELVLYPDAGHGGIFQYHDAFLAKAKAFLAG
Download sequence
Identical sequences A5WY78
WP_012478099.1.51814 gi|190014795|ref|YP_001967559.1|NC_010929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]