SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190570438|ref|YP_001966860.1|NC_010919 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190570438|ref|YP_001966860.1|NC_010919
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.5e-75
Family CAT-like 0.0000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190570438|ref|YP_001966860.1|NC_010919
Sequence length 213
Comment chloramphenicol aminotransferase [Aeromonas hydrophila plasmid pRA3]
Sequence
MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITALRTALAETGYKFYPLMIYLISR
AVNQFPEFRMALKDNELIYWDQSDPVFTVFHKETETFSALSCRYFPDLSEFMAGYNAVTA
EYQHDTRLFPQGNLPENHLNISSLPWVSFDGFNLNITGNDDYFAPVFTMAKFQQEGDRVL
LPVSVQVHHAVCDGFHAARFINTLQLMCDNILK
Download sequence
Identical sequences A9ZTH9 P22615 Q209K7 Q5LK50
gi|190570438|ref|YP_001966860.1|NC_010919 WP_012477888.1.19833 WP_012477888.1.46712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]