SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190894723|ref|YP_001985016.1|NC_010997 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190894723|ref|YP_001985016.1|NC_010997
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.24e-61
Family Biotin biosynthesis protein BioH 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190894723|ref|YP_001985016.1|NC_010997
Sequence length 269
Comment putative 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase [Rhizobium etli CIAT 652 plasmid pC]
Sequence
MGEAQRHTVGDVTLNYRIDGSGDPLVCIHGVGSYLEAWSGVVQRLKDQFTVLTFDLRGHG
HSSRIRGRYEIDDFVDEALALADKAGFQTFNLAGFSLGGLIAQRMALTHLERLRKLILLS
TVAGRTPEERTRVLERLAALRAGTPADHHNASLSRWLTEEFQENNPAVIARLRERDAEND
PDCYAAAYRVLAETDFGGFLDQIRCPTLIATGEADAGSNPRMARYMHERIPGSTLSILPG
LRHSILIEAPETVANLMRGFLTREETNHG
Download sequence
Identical sequences A0A0M3GBV3 A0A192PI24 B3Q5I5 F2A622
WP_004672115.1.10944 WP_004672115.1.22132 WP_004672115.1.25642 WP_004672115.1.35839 WP_004672115.1.49700 WP_004672115.1.76514 WP_004672115.1.79970 WP_004672115.1.81846 WP_004672115.1.82165 gi|190894723|ref|YP_001985016.1|NC_010997 491916.RHECIAT_PC0000388 gi|190894723|ref|YP_001985016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]