SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190894796|ref|YP_001985089.1|NC_010997 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190894796|ref|YP_001985089.1|NC_010997
Domain Number 1 Region: 3-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-63
Family Epoxide hydrolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190894796|ref|YP_001985089.1|NC_010997
Sequence length 289
Comment putative hydrolase [Rhizobium etli CIAT 652 plasmid pC]
Sequence
MFEGFSLETVDVGLGSLRVRIGGEGPAVLLLHGHPRTHLTWSKVADLLSPDYTVVCPDLP
GFGRSYQPVDAADSKNSSKRAKAEALVELMRRLEHENFVVVGHDRGSLTAFRMAMDHPDR
VRKLVIADGIPVIEHLERADWKFARDWYHWFFFAQPAKPERAILADPLAWYDKLSPALMG
RLAYDDLIGVIHDPHVIHGMIEDYRAGLSVDHLHDRADRDAGRKVTCPMLCLWSLRDDME
QIYGDPVAIWRNWADDVRGFGIDSGHHVAEENPEALSAAIREFLEADGA
Download sequence
Identical sequences B3Q5Q8
491916.RHECIAT_PC0000461 gi|190894796|ref|YP_001985089.1| WP_012489967.1.25642 gi|190894796|ref|YP_001985089.1|NC_010997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]