SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209546320|ref|YP_002278210.1|NC_011366 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209546320|ref|YP_002278210.1|NC_011366
Domain Number 1 Region: 8-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.58e-62
Family Haloperoxidase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209546320|ref|YP_002278210.1|NC_011366
Sequence length 275
Comment 3-oxoadipate enol-lactonase [Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202]
Sequence
MTEEIDVQFARINDVTIHYQVIGAPADRPVIVFVNSLGTDFRIWRDVVVRLAGDYAIVLY
DKRGHGLSDVGQLPSSIEDHATDLAGLLDLLSVKDAVILGLSVGGLIAQSLYQRRPDLVG
ALILCDTAHKIGTAESWNARIAAVERNGIGSIVDAIMERWFTPAFRRPESTAYSGYCNML
TRQPVEGYIAACEAIRDADFTEAAKRITVPTICIVGDQDGSTPPDLVLSTAKLIPGARYE
VIPDCAHIPCVEQPEALTVIIRAFLTTLAPGETNR
Download sequence
Identical sequences B6A3X7
gi|209546320|ref|YP_002278210.1| gi|209546320|ref|YP_002278210.1|NC_011366 395492.Rleg2_5939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]