SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219883227|ref|YP_002478389.1|NC_011880 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219883227|ref|YP_002478389.1|NC_011880
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.07e-21
Family Lipase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219883227|ref|YP_002478389.1|NC_011880
Sequence length 132
Comment hypothetical protein Cyan7425_5433 [Cyanothece sp. PCC 7425 plasmid pP742501]
Sequence
MVGNLYLPTSYQPGDKLPVIIVTGAWTTVKEQMPAVYAQRLADRGFAAFTFDFRYWGESG
GTPRQYESPTAKVQDIKNAVAFLQTLPVIDGDRIGGLGICASADYMAQAVVEVTFSCDGF
PLCIAESLSPFV
Download sequence
Identical sequences B8HZ42
gi|219883227|ref|YP_002478389.1|NC_011880 gi|219883227|ref|YP_002478389.1| WP_015939483.1.77409 395961.Cyan7425_5433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]