SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220919993|ref|YP_002495296.1|NC_011892 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220919993|ref|YP_002495296.1|NC_011892
Domain Number 1 Region: 23-152
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000986
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220919993|ref|YP_002495296.1|NC_011892
Sequence length 260
Comment putative dienelactone hydrolase [Methylobacterium nodulans ORS 2060 plasmid pMNOD01]
Sequence
MPTLPDFTTFAFTHAGRERTIYRKGEGPPVLIMHEVPGISAEVVRFARRVVDAGFTVFMP
RLFGPVGVKTTPVNRVAELLRICISREFQVLAENRSSPIADWLRALARHIHDEMDGRGIG
VVGMCVTGNFALTLTLDPWVLAPVMGHPSLPLPITRAKAAAVHVTPETFANARRRTTEEG
LKVLGVRFHGDMLFCRAARFETLRRELGDGFEGIELPAASAKPQFEPPHSVLTIGLIDRE
GEPTHEAVERVLRFLSERLH
Download sequence
Identical sequences B8IWL4
gi|220919993|ref|YP_002495296.1|NC_011892 460265.Mnod_8749 gi|220919993|ref|YP_002495296.1| WP_015934333.1.92880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]