SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222102655|ref|YP_002539694.1|NC_011981 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222102655|ref|YP_002539694.1|NC_011981
Domain Number - Region: 69-146
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000685
Family Carboxylesterase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222102655|ref|YP_002539694.1|NC_011981
Sequence length 271
Comment hypothetical protein Avi_7315 [Agrobacterium vitis S4 plasmid pAtS4e]
Sequence
MSLGCYDIEMRTRNAAVLVVLFSHSTKHHFKSVDFPADVLSIADKEDTYFTNTPDILANF
IKDVSAPYDLVITIGGSKGGHGALYHGTLLARMIEKPVRVLAFSPVVMLSDNPNDVLYVS
YQKLMERAQTTPELAENLRQSTQVITADPPPNLTAFCIVGADNHCDCVEASRLIGAHILT
LPMHHHETVIPFLCDTSDARAVTKTVLVLYDRAAEEADVAHLLEKGSVDKMIADLSRVPK
QPRLDELTNLVIKGDASIVRQAVTTAGALQA
Download sequence
Identical sequences B9K541
WP_015918431.1.42352 WP_015918431.1.44083 WP_015918431.1.73387 WP_015918431.1.78727 gi|222102655|ref|YP_002539694.1| gi|222102655|ref|YP_002539694.1|NC_011981 311402.Avi_7315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]