SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226349482|ref|YP_002776596.1|NC_012520 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226349482|ref|YP_002776596.1|NC_012520
Domain Number 1 Region: 8-172
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.29e-21
Family Epoxide hydrolase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226349482|ref|YP_002776596.1|NC_012520
Sequence length 265
Comment hypothetical protein ROP_pROB01-02450 [Rhodococcus opacus B4 plasmid pROB01]
Sequence
MCRDPALHTWSRYAADVIALLDHLGASEAVVGGTGLGGTIALRAAPAFPSRVRAVVVISA
EDIEDDEAKVAETALVDRFAERVRGDGIEAAWELFLPHLQPLIGNLVRSAIPRADPGSVA
AAAAIGRDRSFRTLDELGAIEVPVLIVPGADERHPAELAERMSATIPHATLARNVSFDAL
ATADDLAGAVVPQIRRFLGNCGHYPSPCVPEPPSSDRRTLAMAMWLGTGTAAQRCLVRGP
GADRACRAASCVAGSGRHASVTLGL
Download sequence
Identical sequences C1BD00
WP_012686865.1.34288 WP_012686865.1.59368 gi|226349482|ref|YP_002776596.1|NC_012520 gi|226349482|ref|YP_002776596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]