SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226357984|ref|YP_002787724.1|NC_012528 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226357984|ref|YP_002787724.1|NC_012528
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000123
Family Carboxylesterase/lipase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226357984|ref|YP_002787724.1|NC_012528
Sequence length 189
Comment dienelactone hydrolase [Deinococcus deserti VCD115 plasmid 3]
Sequence
MSEILLFHHVLGLTKGVHTFAEHLRQAGHTVHTPDLFQGQTFATLDEGIHYAEQVGFKTL
EGRAVRIADELPRHLVYAGFSLGVMPAQKLAQTRTGALGALFFHGCLPPEAYGAGWPTDL
PVQIHAMDADPWFAEDKEAAQVVVHSASNGHLFMYPGDKHLFTDCSLAAYDSGATSLLME
RVLAFLARL
Download sequence
Identical sequences C1D3Z1
546414.Deide_3p02550 gi|226357984|ref|YP_002787724.1| gi|226357984|ref|YP_002787724.1|NC_012528 WP_012695092.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]