SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226358240|ref|YP_002787979.1|NC_012529 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226358240|ref|YP_002787979.1|NC_012529
Domain Number 1 Region: 4-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.05e-62
Family Haloperoxidase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226358240|ref|YP_002787979.1|NC_012529
Sequence length 274
Comment alpha/beta hydrolase fold protein [Deinococcus deserti VCD115 plasmid 2]
Sequence
MPAFAPPKTLKIQGRTVAYSEMTPPEPQGTVLFLPGLGGTRLTWRSQLPVFGRRYRALSV
DHRDTGASDPAPDDYTTAEQADDAAALLRALDAAPAHVVGLSMGGFVALNLAVRHPELLR
SLTLVATSAGGETHVKPDPAGREALRPDFSLSAGEWALRSTRLITAPGWMDANTRLHAGI
AAGADEYPLTPEVHARQFRSTKTHDVTGDLSRLDLPTLVIHGDADPLVRYENGEHLARSI
PGAQFITYAGTGHLPPLERYEDFNRDVLAFLDAH
Download sequence
Identical sequences C1D388
gi|226358240|ref|YP_002787979.1|NC_012529 546414.Deide_2p02080 WP_012695347.1.1337 gi|226358240|ref|YP_002787979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]