SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|227819632|ref|YP_002823603.1|NC_012586 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227819632|ref|YP_002823603.1|NC_012586
Domain Number 1 Region: 6-199
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.01e-44
Family Carboxylesterase/thioesterase 1 0.000000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227819632|ref|YP_002823603.1|NC_012586
Sequence length 200
Comment phospholipase/carboxylesterase [Sinorhizobium fredii NGR234 plasmid pNGR234b]
Sequence
MADHGYVHKLKTGKPGNPILFVLHGTGGDENQFFGFGAELLPEATIVSPRGDVSEYGAAR
FFRRTGEGVYDMADLARATGKMANFVKTLAAEHQASEIIGLGYSNGANILANVLIEEGVF
DKAVLMHPLIPFRPKDNPALEGRKILITAGERDPICPAPLTQALADYFTTQKANVELEWH
SGGHDIRQNEIAAIGRFLKG
Download sequence
Identical sequences C3KRZ2
YP_002823603.1.63916 gi|227819632|ref|YP_002823603.1|NC_012586 394.NGR_b13990 gi|227819632|ref|YP_002823603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]