SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241518590|ref|YP_002979218.1|NC_012853 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241518590|ref|YP_002979218.1|NC_012853
Domain Number 1 Region: 4-256
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.69e-43
Family Carbon-carbon bond hydrolase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241518590|ref|YP_002979218.1|NC_012853
Sequence length 273
Comment alpha/beta hydrolase fold protein [Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503]
Sequence
MLTFEENGHGEPLVLLHGLGGSARSWDLLVPELQKHRRLILLNLPGHGGSPLTSDAATFD
GMVAAVEAFLETRGITSIDVVGSSLGGRIVLELARRGRVRSAIALDPGGFWHGWERHYIF
ASLMGTIKLIRALGSQRKILAKPGIRSVSIRQLSHKPSALSQPFVEQEIRSCAAASNFED
IVRDLTSIPPQMGPAADNVQSVAIGWGRQDKLCFPGQAIRAQTAFPGSILRWFDACGHFP
IWDQPSLTVQFILQCLDLERNSDEQRASMQQGI
Download sequence
Identical sequences C6B8D5
395491.Rleg_5901 gi|241518590|ref|YP_002979218.1|NC_012853 gi|241518590|ref|YP_002979218.1| WP_012760517.1.14669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]