SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241666922|ref|YP_002985006.1|NC_012858 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241666922|ref|YP_002985006.1|NC_012858
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.15e-35
Family Carboxylesterase/thioesterase 1 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241666922|ref|YP_002985006.1|NC_012858
Sequence length 198
Comment phospholipase/carboxylesterase [Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502]
Sequence
MASHDHLVIFLHGIGASGAQLMPLASSWRPKLPNTRFVAPEAPMHHRYGHQWFSTEGNPL
DAARIRTAREAFDVLISDVVRREGFAEAHDRVAFVGVSQGAIVALDAVASGRWHAGALVA
FSGLLPPQPISPSGKSTPILLVHGENDTTIPPIASRLAAAQLGTAGFKVELDVERGTGHT
ISSAGAQKALSFLKKNLP
Download sequence
Identical sequences C6B7I6
395491.Rleg_7027 gi|241666922|ref|YP_002985006.1|NC_012858 gi|241666922|ref|YP_002985006.1| WP_012763467.1.14669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]