SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288986977|ref|YP_003456940.1|NC_013862 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288986977|ref|YP_003456940.1|NC_013862
Domain Number 1 Region: 5-168
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.81e-25
Family Bacterial lipase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288986977|ref|YP_003456940.1|NC_013862
Sequence length 197
Comment lipase, class 2 [Allochromatium vinosum DSM 180 plasmid pALVIN02]
Sequence
MSDSKNIVLVHGIFDTERIFKNVSNLMTAHGYKTFSINLRPNYGIAGIEDLAFQLKIFAE
SKIPRGEQFSLIGFSMGGIVSRHYLQNLGGTNNVNKFIAVSSPHYGTVLSYLLPLKGSLQ
MRPGSTYLRNLNSNVDSLLPVRPVSFWTKYDQMIIPQKSAIMSVGDSVQMPIFPHRRMVT
SKLASHALVECIRKNEF
Download sequence
Identical sequences D3RWH8
WP_012979615.1.50894 gi|288986977|ref|YP_003456940.1| gi|288986977|ref|YP_003456940.1|NC_013862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]