SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294508945|ref|YP_003565834.1|NC_014023 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508945|ref|YP_003565834.1|NC_014023
Domain Number 1 Region: 6-268
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.66e-31
Family Epoxide hydrolase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508945|ref|YP_003565834.1|NC_014023
Sequence length 279
Comment hydrolase, alpha/beta fold family [Bacillus megaterium QM B1551 plasmid pBM700]
Sequence
MTVVKNGTLQIPEAILYYEVRGSGPILLLIHGGGGDADKFNNIADHLADKYTVVTYDRRG
HSRSNLIGKTEDYKVETHSKDAHLLLAELTDKPAYVFGSSSGAVIGLDLCIRYSGQVRGM
IPHEPVLLQLLFGNELKQAEQFMEDLQNNHRSEVIKLLSNLEMNDAKPKQSIDVLTERLL
SNSTYFTKYEIPGILNYTLDINKLSTLLKSSSIKIFPAGGSASRDLFPYGCAATLAEQLG
TEFVEFPGHHAGFDTTHPEEFAERLHNVLITKIFKRYNE
Download sequence
Identical sequences D5E446
WP_013059960.1.64554 gi|294508945|ref|YP_003565834.1| gi|294508945|ref|YP_003565834.1|NC_014023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]