SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297567862|ref|YP_003686833.1|NC_014213 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297567862|ref|YP_003686833.1|NC_014213
Domain Number 1 Region: 21-74
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000267
Family Haloperoxidase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297567862|ref|YP_003686833.1|NC_014213
Sequence length 85
Comment hypothetical protein Mesil_3526 [Meiothermus silvanus DSM 9946 plasmid pMESIL01]
Sequence
MRYVLASSFFFALLPQAFGQSIQPIKIQVNGVELYCIEKGQGETLILLHGGMGDYRSWNP
QIQTFAPDYRVISYADAIITRIKIL
Download sequence
Identical sequences D7BJG9
WP_013159802.1.93385 gi|297567862|ref|YP_003686833.1| gi|297567862|ref|YP_003686833.1|NC_014213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]