SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307592423|ref|YP_003900014.1|NC_014533 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307592423|ref|YP_003900014.1|NC_014533
Domain Number 1 Region: 16-244
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.86e-22
Family Carbon-carbon bond hydrolase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307592423|ref|YP_003900014.1|NC_014533
Sequence length 263
Comment hypothetical protein Cyan7822_6110 [Cyanothece sp. PCC 7822 plasmid Cy782201]
Sequence
MALINNHQPYFFAPNPLKKNAPLFVFLPGMDETAKELMKIQIGDLETVFDVRCFVIPADN
LTDWEHLSSQAIKLTRSELEQKPQATVYLCGESFGGCLALKILQQEPELFDRIILINPAS
SFHRVPWLNLGSYLLPWTPKIIYDLSSILTVPCLAPLNRLSSQSRQALLKATRSAPKATA
AKRLALLREFRVSENQLQKITKPVLLIASKGDLILPSLSEIKRLAPYFKDVKTITLPNSG
HACLAQTNVNLRLLLQKAEFLPE
Download sequence
Identical sequences E0ULW8
WP_013334698.1.91546 gi|307592423|ref|YP_003900014.1| gi|307592423|ref|YP_003900014.1|NC_014533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]