SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|308189367|ref|YP_003933497.1|NC_014563 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308189367|ref|YP_003933497.1|NC_014563
Domain Number 1 Region: 4-190
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.08e-29
Family Hypothetical protein VC1974 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308189367|ref|YP_003933497.1|NC_014563
Sequence length 233
Comment s-acyl fatty acid synthase thioesterase, medium chain [Pantoea vagans C9-1 plasmid pPag2]
Sequence
MCLIFVLPHAGGGAHHYYGWAEHLSPEIQWEPLDYAGHFSRMDEPLYTTFEQAIQDLAGK
IIDRACGQPFGLFGHSMGGALAYEISQYLTERQMAEDLLFIAISSALPSNRRDPGMTRYY
ELPDRDFIQHLIDTGGMTKQMAAESELMASYLPLIRQDYRLYHQYQSPLHPPLKIPLYTL
WGNKRRIVTTICRHGRITVTLLMEVNLIQATTSTGDIVWTRLPLIFRLSFAKH
Download sequence
Identical sequences E1PKV9
gi|308189367|ref|YP_003933497.1|NC_014563 gi|308189367|ref|YP_003933497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]