SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310830203|ref|YP_003965303.1|NC_014626 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|310830203|ref|YP_003965303.1|NC_014626
Domain Number - Region: 24-93
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0137
Family Carbon-carbon bond hydrolase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310830203|ref|YP_003965303.1|NC_014626
Sequence length 96
Comment hypothetical protein EIO_3196 [Ketogulonicigenium vulgare Y25 plasmid pYP12]
Sequence
MGTRYYIRWYLALTLIGVLPIISVTLAGLIATVNGCVLHEGGVSPCLIMGHDFGGALHTM
TVLGWLMLITNFALLAGVLGLVWEGVKAVFRAIFNR
Download sequence
Identical sequences E3F5K8 F9YBD7
gi|310830203|ref|YP_003965303.1| WP_013385651.1.38423 WP_013385651.1.51946 YP_005796442.1.93432 gi|310830203|ref|YP_003965303.1|NC_014626 gi|385235101|ref|YP_005796442.1|NC_017385 gi|385235101|ref|YP_005796442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]