SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313117308|ref|YP_004044291.1|NC_014735 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313117308|ref|YP_004044291.1|NC_014735
Domain Number 1 Region: 9-214
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.27e-37
Family Proline iminopeptidase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313117308|ref|YP_004044291.1|NC_014735
Sequence length 216
Comment dienelactone hydrolase-like enzyme [Halogeometricum borinquense DSM 11551 plasmid pHBOR01]
Sequence
MDRTTDAVLSIPLDDVTLEGELIVPRDASGIVVFAHGSGSSRHSPRNNFVAGRLHEAGLA
TLLFDLLTEDEDRSRENRFDIPLLTDRLVAVTEWLRQRDDTAELTIGYFGSSTGAAAALR
ATASDDTSVDAVVSRGGRVDMADAVLDTITAPTLLIVGGNDESVRRLNQEAHAKLSCSKS
LHVVPGAGHLFEGEGELEEVADVAADWFAEHLGNPN
Download sequence
Identical sequences E4NUB0
gi|313117308|ref|YP_004044291.1|NC_014735 gi|313117308|ref|YP_004044291.1| WP_006055999.1.71935 WP_006055999.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]