SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317133845|ref|YP_004089756.1|NC_014824 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317133845|ref|YP_004089756.1|NC_014824
Domain Number 1 Region: 11-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.05e-28
Family Haloalkane dehalogenase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317133845|ref|YP_004089756.1|NC_014824
Sequence length 277
Comment hypothetical protein Rumal_3417 [Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL01]
Sequence
MKAKFRKDLEFVKINGHKLHIFRCGDANKPKLVFMSGSGTVAPIYDFKVLYKKLLDDYRI
IVIEKFGYGYSDLYECPCDIDSVVSYQKQALKMIGEKAPYILLPHSMSGIEAIRWKQMYP
DDIKAIIGLDMATPLTYMEWGNKEIHKRLELMRRLKKLNNLGLMFWYPISKRELNKDEIQ
QHNLLKRRNLMNNCYVNEAMQVLKNAKIVARAGKAECPTLMFVSDGKQTSPNWISNEQKY
AKSVNAETVFLNCGHYIHYYESDKISSKIKAFLSKLA
Download sequence
Identical sequences E6UJM4
WP_013483420.1.49193 WP_013483420.1.63498 gi|317133845|ref|YP_004089756.1|NC_014824 gi|317133845|ref|YP_004089756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]