SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319788786|ref|YP_004090101.1|NC_014825 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319788786|ref|YP_004090101.1|NC_014825
Domain Number 1 Region: 42-228
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.59e-29
Family Carboxylesterase/thioesterase 1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319788786|ref|YP_004090101.1|NC_014825
Sequence length 237
Comment hypothetical protein Rumal_3782 [Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02]
Sequence
MNSTRRKNTIIIGNRPCTVYFDPAPKYLLIQPTGEHEREHLDKEVEYIKSLTNTPSIFAA
FEVDNWNKELSPWNAPPVFGKEPFGSYAGETLAYLEDTLIPEIIKRYSLKENIPVILGGY
SLAGLFALWSAYTSDRFTAVAGVSPSVWFPRWLDFIAEHSPAAKNIYLSLGRKEEKNRNQ
TMAAVGDNIRRQYEMLKAMNLSATLEWNEGNHFTEPEIRTAKGFSWCINELTKENDT
Download sequence
Identical sequences E6UKL9
gi|319788786|ref|YP_004090101.1| WP_013483760.1.49193 WP_013483760.1.63498 gi|319788786|ref|YP_004090101.1|NC_014825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]