SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|322835456|ref|YP_004215482.1|NC_015062 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322835456|ref|YP_004215482.1|NC_015062
Domain Number 1 Region: 26-244
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.11e-28
Family Hypothetical protein VC1974 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322835456|ref|YP_004215482.1|NC_015062
Sequence length 252
Comment hypothetical protein Rahaq_4776 [Rahnella sp. Y9602 plasmid pRAHAQ01]
Sequence
MRLRVVSTLLFAATAAFGCQAATAAPVKNIVLVHGAFVGGSGWRPVYDILTRDGYKVTLV
QEPLTSFAEDVAATKRILDRQNGPAILVGHSYGGAIITEAGNDPHVAGLVYIAAHALDNG
ETEAINGKKFPNSAHPFVKTPDGFLYINPANFPSDFAADLPRKQAEFEAQAQMLTSASVF
TANIPDPAWKVKPSWYMVAKADKIINPDLERMYAKRAHSHTVEIAGASHSVYESHPKEVA
ALIEQAAMGAVK
Download sequence
Identical sequences A0A0H3FHW7 H8NZK8
gi|322835456|ref|YP_004215482.1|NC_015062 gi|384527905|ref|YP_005419137.1|NC_017060 gi|322835456|ref|YP_004215482.1| gi|384527905|ref|YP_005419137.1| WP_013578036.1.59798 WP_013578036.1.91760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]