SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32455821|ref|NP_862473.1|NC_004956 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32455821|ref|NP_862473.1|NC_004956
Domain Number 1 Region: 4-215
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.18e-80
Family CAT-like 0.000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32455821|ref|NP_862473.1|NC_004956
Sequence length 216
Comment dihydrolipoamide acetyltransferase-like protein [Pseudomonas sp. ADP plasmid pADP-1]
Sequence
MPSKNLHRNWVVIPHVTNHDDADITDLEAFRVQFNKENEKSGVKVTMLAFMIKAAVAALK
KFPEFNSSLDGDQLVMKNYFHIGFAADTPNGLVVPVIKDADQKGIVQISKEMGELAAKAR
EGKLAPADMQGGCFSISSLGGIGGRYFTPIINAPEVAIMGVCKSSIEPKWDGKQFAPRLM
LPLSLSWDHRVIDGAAAARFNVYFASLLADFRRIVM
Download sequence
Identical sequences A0A2H4I9J3 Q933U5
gi|32455821|ref|NP_862473.1|NC_004956 gi|32455828|ref|NP_862480.1|NC_004956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]