SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333917563|ref|YP_004483512.1|NC_015561 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|333917563|ref|YP_004483512.1|NC_015561
Domain Number - Region: 25-82
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00926
Family Haloperoxidase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333917563|ref|YP_004483512.1|NC_015561
Sequence length 153
Comment hypothetical protein AS9A_P20006 [Amycolicicoccus subflavus DQS3-9A1 plasmid pAS9A-2]
Sequence
MFRKAFAIIAAAVVIPTAVGVGAAAAEPSQPEPLPPAATLPGASPEDEPIQPLGTHWYGS
GYVTVAQDWYSHQQSFGTWSSFSSITGVVNARFQVRVLDRNGSVLQEQNRYFDGRRFRET
VYMNHHVPRPAGSVCTTLWEGGHQLGTACEAIH
Download sequence
Identical sequences F6ESC9
gi|333917563|ref|YP_004483512.1|NC_015561 WP_013798057.1.101151 gi|333917563|ref|YP_004483512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]