SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337735091|ref|YP_004634539.1|NC_015686 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337735091|ref|YP_004634539.1|NC_015686
Domain Number 1 Region: 4-215
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.67e-62
Family CAT-like 0.0000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337735091|ref|YP_004634539.1|NC_015686
Sequence length 220
Comment chloramphenicol O-acetyltransferase [Clostridium acetobutylicum DSM 1731 plasmid pSMBa]
Sequence
MNSNFHAIDMNTYPRAHTYNYFTKTVSTLIYSINITLDVTILRATLKNKGLKFFPAYVYL
VTRAIGRHQEFLMAIQNDMLGYWDCRTPFYPIFHEDDKTITFLWTEYNEDFEVFYKNYIS
DIREYGNNHGIMLSKDAPPSNNYIISCIPWFSFNSLSMQLQNAKNYYAPIFEAGRFTETN
GIITLPLSITVNHATVDGYHIKLLLDELQWSMSHPKEWIR
Download sequence
Identical sequences Q97TN8
gi|15004764|ref|NP_149224.1| gi|337735091|ref|YP_004634539.1| gi|384456600|ref|YP_005672937.1| 272562.CA_P0060 NP_149224.1.94244 WP_010890745.1.17575 WP_010890745.1.17905 WP_010890745.1.48544 WP_010890745.1.57811 WP_010890745.1.71350 WP_010890745.1.92914 gi|15004764|ref|NP_149224.1|NC_001988 gi|337735091|ref|YP_004634539.1|NC_015686 gi|384456600|ref|YP_005672937.1|NC_017296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]